DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and RpL10Aa

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster


Alignment Length:83 Identity:27/83 - (32%)
Similarity:36/83 - (43%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMK-HKTFLRNG--LKDVQTR 77
            |...||    :|..|..|.|.|:.: ...|.||| .|..||.||..| :..||.:.  :|.:...
  Fly    65 VCVFGD----QEHCYKAKAIGVDCL-DVEALKKL-NKDPKLTKKLSKAYDVFLASESIIKQIPRL 123

  Fly    78 LRKGETGICIFAGDVTPV 95
            |..|.|....|   :||:
  Fly   124 LGPGLTNAGKF---LTPL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 15/48 (31%)
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.