DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and RpS12

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster


Alignment Length:148 Identity:31/148 - (20%)
Similarity:53/148 - (35%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQTRLRKG 81
            :|..||.:.......|..:.:|.     |.:::.||  .|:...:.|      |:......|.|.
  Fly     1 MADVDVDVPSAAPVLDGAMDINT-----ALQEVLKK--SLIADGLVH------GIHQACKALDKR 52

  Fly    82 ETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKR-----------GTVALL 135
            :..:||.|......:....:.|:|.|..||.....|...||...|:.:           |...::
  Fly    53 QAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVV 117

  Fly   136 VRQNEEYKDLYDEVKEEL 153
            ::...|.....|.||:.|
  Fly   118 IKDFGEETPALDVVKDHL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 21/105 (20%)
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.