DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and snu13

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_988994.1 Gene:snu13 / 394590 XenbaseID:XB-GENE-963821 Length:128 Species:Xenopus tropicalis


Alignment Length:122 Identity:38/122 - (31%)
Similarity:64/122 - (52%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHL 101
            ||..|.|:|..:|.|....||::|..:|. ||.|..:....|.:|.....:.|.|..|::|:.||
 Frog     6 VNPKAYPLADAQLTKTLLDLVQQAANYKQ-LRKGANEATKTLNRGIAEFIVMAADAEPLEIILHL 69

  Fly   102 PAVCEEKGIPYTYTPSRADLGAAMGVKRGTV--ALLVRQNEEYKDLYDEVKEELSAL 156
            |.:||:|.:||.:..|:..||.|.||.|..:  |:.:::..:.|.....:::.:..|
 Frog    70 PLLCEDKNVPYVFVRSKQALGRACGVSRPVIACAVTIKEGSQLKPQIQSLQQSIERL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 31/96 (32%)
snu13NP_988994.1 Rpl7Ae 9..103 CDD:224277 33/94 (35%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000250|UniProtKB:P55769 36..48 3/11 (27%)
Important for U4 snRNA-binding. /evidence=ECO:0000250|UniProtKB:P55769 96..128 4/31 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.