DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and nhp2

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_988989.1 Gene:nhp2 / 394586 XenbaseID:XB-GENE-973261 Length:149 Species:Xenopus tropicalis


Alignment Length:159 Identity:75/159 - (47%)
Similarity:109/159 - (68%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKT 65
            |.|.|.|.||:..|:          ..:|||:.|.::|.||||:||:||.||.||.||||:|.|.
 Frog     1 MTKAKKEESEEVPET----------PSKSYDELLAYLNPIAKPLAGRKLTKKLYKCVKKAIKQKN 55

  Fly    66 FLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRG 130
             :|.|:|:||..:.|||.||.:.|||..|:::.||:|.:||::||||:|.||::|||||.|.||.
 Frog    56 -IRRGVKEVQKFINKGEKGIVVMAGDTLPIEVYCHIPVMCEDRGIPYSYVPSKSDLGAAAGSKRP 119

  Fly   131 TVALLVRQNEEYKDLYDEVKEELSALNIP 159
            |..:|::.:|:|::.|||..|::.||.:|
 Frog   120 TCVILIKPHEDYQEAYDECLEDVQALPLP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 48/94 (51%)
nhp2NP_988989.1 Ribosomal_L7Ae 41..135 CDD:366537 48/94 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6247
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 158 1.000 Inparanoid score I4171
OMA 1 1.010 - - QHG53726
OrthoDB 1 1.010 - - D1538526at2759
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto104661
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R810
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.