powered by:
Protein Alignment NHP2 and CG11808
DIOPT Version :9
Sequence 1: | NP_001261849.1 |
Gene: | NHP2 / 44005 |
FlyBaseID: | FBgn0029148 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611021.1 |
Gene: | CG11808 / 36687 |
FlyBaseID: | FBgn0034000 |
Length: | 219 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 16/52 - (30%) |
Similarity: | 24/52 - (46%) |
Gaps: | 5/52 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 DESV-VASGDVTIKEEESYDDKLIFVNAIAKP-MAGKKLAKKCYKLVKKAMK 62
:|:| |||...|....| |.:...|.:..| |..:|..:|.|...:|.|:
Fly 170 NETVTVASKPATAVRNE---DVIFHPNFLGDPDMKAEKWLRKLYNYRQKYMQ 218
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
NHP2 | NP_001261849.1 |
Ribosomal_L7Ae |
51..146 |
CDD:396000 |
4/12 (33%) |
CG11808 | NP_611021.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.