DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and rps12

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001269106.1 Gene:rps12 / 337007 ZFINID:ZDB-GENE-030131-8951 Length:132 Species:Danio rerio


Alignment Length:151 Identity:28/151 - (18%)
Similarity:57/151 - (37%) Gaps:40/151 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQT 76
            |:|.:.|.|             ::.||. |.|           :::|.|:.|....| |:::...
Zfish     2 AEEGIAAGG-------------VMDVNT-ALP-----------EVLKTALIHDGLAR-GIREAAK 40

  Fly    77 RLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKR-----------G 130
            .|.|.:..:|:.|.:......:..:.|:|.|..|..........||..:|:.:           |
Zfish    41 ALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVG 105

  Fly   131 TVALLVR---QNEEYKDLYDE 148
            ...::::   :..:.||:.:|
Zfish   106 CSCVVIKDYGKESQAKDVIEE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 19/108 (18%)
rps12NP_001269106.1 Ribosomal_L7Ae 16..111 CDD:396000 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.