DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and RpL7A

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster


Alignment Length:126 Identity:33/126 - (26%)
Similarity:59/126 - (46%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IAKPMAGKKLAK-KCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPA 103
            :||.:..||:|: |......:..|..:::..|...|...:.:.:..:.:.|.||.|::::..|||
  Fly   113 LAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPA 177

  Fly   104 VCEEKGIPYTYTPSRADLGAAMGVKR-GTVALLVRQN----------EEYKDLYDEVKEEL 153
            :|.:.|:||.....:|.||..:..|. .|:||....|          |..|..::|..||:
  Fly   178 LCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 25/106 (24%)
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 33/126 (26%)
Ribosomal_L7Ae 37..257 CDD:294400 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.