DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and Nhp2

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_003750866.1 Gene:Nhp2 / 287273 RGDID:1309435 Length:153 Species:Rattus norvegicus


Alignment Length:162 Identity:70/162 - (43%)
Similarity:106/162 - (65%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKV--ERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKH 63
            |.|:||  |.||...|.        ..||.:|::.|:.:|.||:|:|.::|.:|.||.:|||:|.
  Rat     1 MTKIKVVPEESEAQAEG--------CSEERTYEELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQ 57

  Fly    64 KTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVK 128
            |. :|.|:|:||..:.|||.||.:.|||..|:::.||||.:||::.:||.|.||:.|||||.|.|
  Rat    58 KQ-IRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDQNLPYVYIPSKTDLGAATGSK 121

  Fly   129 RGTVALLVRQNEEYKDLYDEVKEELSALNIPV 160
            |.|..::|:.:|:|::.||:..||:.||..|:
  Rat   122 RPTCVIMVKPHEDYQEAYDKCLEEVQALPTPL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 45/94 (48%)
Nhp2XP_003750866.1 SNU13 32..130 CDD:411046 48/98 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338615
Domainoid 1 1.000 105 1.000 Domainoid score I6520
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4374
OMA 1 1.010 - - QHG53726
OrthoDB 1 1.010 - - D1538526at2759
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto97968
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.