DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and Rpl7a

DIOPT Version :10

Sequence 1:NP_651965.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_038749.1 Gene:Rpl7a / 27176 MGIID:1353472 Length:266 Species:Mus musculus


Alignment Length:104 Identity:29/104 - (27%)
Similarity:46/104 - (44%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMG 126
            |....||.|:..|.|.:...:..:.:.|.||.|::::..|||:|.:.|:||.....:|.||..:.
Mouse   131 KRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGHLVH 195

  Fly   127 VKRGTVALLVRQNEE---------------YKDLYDEVK 150
            .|..|.....:.|.|               |.|.|||::
Mouse   196 RKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_651965.1 Ribosomal_L7Ae 51..146 CDD:426153 26/98 (27%)
Rpl7aNP_038749.1 SNU13 16..266 CDD:455736 29/104 (28%)

Return to query results.
Submit another query.