DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and Dock4

DIOPT Version :10

Sequence 1:NP_651965.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_006515148.1 Gene:Dock4 / 238130 MGIID:1918006 Length:1980 Species:Mus musculus


Alignment Length:116 Identity:25/116 - (21%)
Similarity:45/116 - (38%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DVTIKEEESYDDKLIFVN--AIAKPMAGKKLAKKCYKLVKKAM-------KHKTFLRNGLKDVQT 76
            |..:....|...:..||.  .::.|..|:|:|:....::::|.       .|:.|:...::.:..
Mouse  1519 DAAVNGGVSRYQEAFFVKDYILSHPEDGEKIARLRELMLEQAQILEFGLAVHEKFVPQDMRPLHK 1583

  Fly    77 RL------RKGETGI-----CIFAGDVTPVDIMCHLPAVCEEKGIPYTYTP 116
            :|      .|...||     ||.|   :||......|.||.... |.:.:|
Mouse  1584 KLVDQFFVMKSSFGIQEFPACIQA---SPVHFPNGSPRVCRNSA-PASMSP 1630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_651965.1 Ribosomal_L7Ae 51..146 CDD:426153 17/84 (20%)
Dock4XP_006515148.1 SH3_DOCK4_B 10..65 CDD:212982
DOCK_N 73..392 CDD:465040
C2_Dock-B 400..584 CDD:176077
DHR2_DOCK4 1206..1596 CDD:212578 13/76 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.