DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and Y48A6B.3

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_499415.1 Gene:Y48A6B.3 / 176531 WormBaseID:WBGene00012964 Length:163 Species:Caenorhabditis elegans


Alignment Length:162 Identity:77/162 - (47%)
Similarity:106/162 - (65%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKVERSEDADESVV--ASGDVT--IKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAM 61
            |||..::  |..:||.|  |:||.|  ..|::.|......||.||:|:|.:|||||.|||:|||.
 Worm     1 MGKRNLD--ETMNESTVSEANGDATAPTTEKDEYQALCELVNPIAQPLANRKLAKKVYKLIKKAS 63

  Fly    62 KHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMG 126
            .....||.|:||||..||:.|.||||.||:|:|:|:..|:|.:||||.|||.|.|||..||.|:|
 Worm    64 AGDKTLREGIKDVQKELRRNEKGICILAGNVSPIDVYSHIPGICEEKEIPYVYIPSREQLGLAVG 128

  Fly   127 VKRGTVALLVRQNEEYKDLYDEVKEELSALNI 158
            .:|.::.:.|:.:.::|:|||||.|.|..|.:
 Worm   129 HRRPSILIFVKPSGDFKELYDEVAEALRHLTV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 47/94 (50%)
Y48A6B.3NP_499415.1 Ribosomal_L7Ae 53..148 CDD:279573 47/94 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158422
Domainoid 1 1.000 106 1.000 Domainoid score I4135
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 147 1.000 Inparanoid score I3008
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53726
OrthoDB 1 1.010 - - D1538526at2759
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto20214
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R810
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.