DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and snu-13

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001379076.1 Gene:snu-13 / 174645 WormBaseID:WBGene00010896 Length:128 Species:Caenorhabditis elegans


Alignment Length:124 Identity:46/124 - (37%)
Similarity:72/124 - (58%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHL 101
            ||..|.|:|...|::|...||::||.:|. |:.|..:....|.:|.:.|.:.|.|..|::|:.||
 Worm     6 VNPKAFPLADTNLSQKLMDLVQQAMNYKQ-LKKGANEATKTLNRGISEIIVMAADAEPLEILLHL 69

  Fly   102 PAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALLVRQNE--EYKDLYDEVKEELSALNI 158
            |.:||:|.:||.:..|:|.||.|.||.|..:|..:.|||  :.|....::||::..|.|
 Worm    70 PLLCEDKNVPYVFVRSKAALGRACGVTRPVIAASITQNEGSQLKSQIQKIKEDVEKLLI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 36/96 (38%)
snu-13NP_001379076.1 SNU13 7..128 CDD:411046 44/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.