DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sras and rce1

DIOPT Version :9

Sequence 1:NP_524673.3 Gene:Sras / 44002 FlyBaseID:FBgn0029121 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001016246.1 Gene:rce1 / 549000 XenbaseID:XB-GENE-979449 Length:308 Species:Xenopus tropicalis


Alignment Length:279 Identity:110/279 - (39%)
Similarity:167/279 - (59%) Gaps:22/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVSCCFVLAVLYVGSLYIWSTKHNRDHPTTVKRRFASVSMVMLAAPFFVYFFSS-PELLSRVPFP 93
            ||..|..||..||||||:|.::..||||..:|:||.||.:|.|.:|.|:..:.. ..:.:..|..
 Frog    17 SVFWCLTLACSYVGSLYVWKSELPRDHPAVIKKRFTSVLIVSLLSPLFLSLWKEMTGVKTDAPLL 81

  Fly    94 KLLGLRLEGLWQAVVIPYSLTVLLFLGPI----------FVNMQNESVRSYFDLDYWRGSFGSII 148
            .|:|||:||:..|.::|..||::|||||:          |:    :.::..||..:|......:.
 Frog    82 SLMGLRIEGIITAAILPLLLTMVLFLGPLVQLSLDCPWDFL----DGLKVGFDPRFWILCVSDMR 142

  Fly   149 WVRNHVIAPLSEEFVFRACMMPLILQSFSPLVAVFITPLFFGVAHLHHIAERLSLGVELSTAL-- 211
            |:||.|||||:||.||||||:|:::....|..|:|..|||||:||.||:.|::..  ..:|.|  
 Frog   143 WLRNQVIAPLTEELVFRACMLPMLVPCTGPGPAIFTCPLFFGIAHFHHVIEQIRF--RQATVLSI 205

  Fly   212 -LIGLFQFIYTTLFGFYSAFLFARTGHVMAPILVHAFCNHMGLPDLQDLWQQDLWRRVVAIILYL 275
             |..:|||.||.:||.|:||:|.||||::.|:|.|:|||::|.|.:....:..  :|...|:.|.
 Frog   206 FLSAVFQFSYTAVFGAYTAFIFIRTGHLIGPVLCHSFCNYIGFPAIFGALEHP--QRYTIILFYF 268

  Fly   276 AGFVGWMFLVPLATDPSIY 294
            .|.|.::.|:...|:|::|
 Frog   269 LGVVLFILLLYPMTEPTLY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrasNP_524673.3 YdiL <72..253 CDD:224185 77/194 (40%)
Abi 147..249 CDD:280650 52/104 (50%)
rce1NP_001016246.1 Abi 150..245 CDD:376806 48/96 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3769
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58442
OrthoDB 1 1.010 - - D1607650at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13046
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1074
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.