DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt6 and SUPT6H

DIOPT Version :10

Sequence 1:NP_651962.2 Gene:Spt6 / 44000 FlyBaseID:FBgn0028982 Length:1831 Species:Drosophila melanogaster
Sequence 2:NP_003161.2 Gene:SUPT6H / 6830 HGNCID:11470 Length:1726 Species:Homo sapiens


Alignment Length:55 Identity:10/55 - (18%)
Similarity:24/55 - (43%) Gaps:14/55 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NSIMICSSW----STTSVEDIGKEAKIVGATI--------WFQLYVYKDRAITES 146
            :.::|.::|    .::|...:|....:..|.:        |  :|||.::.:..|
Human    33 SGLVIVTAWMALCHSSSKNSVGGRMHLAIAVVITLFPLLSW--VYVYMNKEMRSS 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt6NP_651962.2 HTH_44 308..410 CDD:464230
Tex 565..1278 CDD:441786
RuvC-like 781..935 CDD:473878
HHH_5 939..1042 CDD:473956
SH2_2 1312..1522 CDD:464227
SUPT6HNP_003161.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..199 10/55 (18%)
Interaction with PAAF1. /evidence=ECO:0000269|PubMed:22316138 2..916 10/55 (18%)
Interaction with IWS1. /evidence=ECO:0000250 2..485 10/55 (18%)
Interaction with KDM6A. /evidence=ECO:0000250 317..1300
HTH_44 <347..422 CDD:464230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..520
Tex 564..1130 CDD:441786
YqgF 775..931 CDD:258777
HHH_7 935..1038 CDD:291309
S1 <1227..1282 CDD:197648
SH2_2 1308..1512 CDD:464227
Interaction with histone H2B and H3. /evidence=ECO:0000269|PubMed:10933715 1633..1726
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1636..1726
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.