DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt6 and eepd1

DIOPT Version :9

Sequence 1:NP_001284936.1 Gene:Spt6 / 44000 FlyBaseID:FBgn0028982 Length:1831 Species:Drosophila melanogaster
Sequence 2:NP_991322.1 Gene:eepd1 / 402965 ZFINID:ZDB-GENE-040426-1831 Length:550 Species:Danio rerio


Alignment Length:400 Identity:73/400 - (18%)
Similarity:133/400 - (33%) Gaps:150/400 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 QERVPREQLLEQ--LSLQFINRTSEVGLDINLM-----VQNSRTINLLQYICGLGPRKGQAL-LK 1006
            |||:......|:  ::|..:||    |:..|::     :...:.:..|..:.|:|..|.:|: |:
Zfish    38 QERLNINTATEEELMTLPGVNR----GVAQNIVEYRDCIGGFKKVEDLALVSGVGATKLEAIKLE 98

  Fly  1007 LLKQSNQRLENRTQLVTVCHLGP------RVFINCSGFIKIDTS------SLGDSTEAYVEVLDG 1059
            :...|.....|.:         |      ...:.|:| :.|:|:      |:...||        
Zfish    99 ICVSSKNSSSNHS---------PSSLRKEHEHLPCTG-VNINTATPPQLMSVRGITE-------- 145

  Fly  1060 SRVHPETYEWARKMAIDAMEYDDEETNPAGALEEILESPE-RLKDLDLDAFAVELERQ------- 1116
                        |:|.:.:|:.... .|..::|::::... ....||...|.|.:||.       
Zfish   146 ------------KIAKNIVEFRSVH-GPFKSIEDLVKVANINSSLLDRIRFQVFVERSRTPSTNT 197

  Fly  1117 --GFGSKSITLYDIRNELSCLYKDYRTPYTKPSAEELFDMLTKETPDSFYVGKCVTAMVTGFTYR 1179
              ||...|.|.:.::::      :...|...|      .::|...|       ||          
Zfish   198 NGGFTHPSPTSFSVQSD------EPDVPLGGP------PLVTSVRP-------CV---------- 233

  Fly  1180 RPQGDQLDSANPVRLDSNESWQCPFC--HKDDFPELSEVWNHFDANACPGQPSGVRVRLENGLPG 1242
            .|.....|....||:   .:|....|  .|.:.|.:.||       .|       ...|||.:. 
Zfish   234 EPPAGTRDGKPVVRV---ATWNLQRCSSEKANNPGVKEV-------VC-------MTLLENDIK- 280

  Fly  1243 FIHIKNLSDRQVRNPEERVRVSQMIHVRIIKIDIDRFSVE------CSSRTADLKDVNNEWRPRR 1301
            .:.:::|:||:.                     :|:|..|      ||.|         .|:..|
Zfish   281 LLAVQDLADREA---------------------LDKFCAELNQPTLCSVR---------RWKSAR 315

  Fly  1302 DNYYDYVTEE 1311
            ..:...|:|:
Zfish   316 GLWKCAVSEK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt6NP_001284936.1 HTH_44 308..411 CDD:291314
RuvC_resolvase 781..935 CDD:304378
HHH_5 939..1042 CDD:304555 20/105 (19%)
DLD 1057..1159 CDD:291540 18/111 (16%)
S1 1220..1281 CDD:278972 9/60 (15%)
SH2_2 1309..1523 CDD:291307 1/2 (50%)
SH2_Nterm_SPT6_like 1336..1420 CDD:198174
SH2_Cterm_SPT6_like 1429..1524 CDD:198182
eepd1NP_991322.1 HHH_3 38..96 CDD:289597 14/61 (23%)
HHH_3 126..182 CDD:289597 13/77 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 4/27 (15%)
MnuA_DNase1-like 246..521 CDD:197338 25/127 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.