DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and STK40

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001269475.1 Gene:STK40 / 83931 HGNCID:21373 Length:440 Species:Homo sapiens


Alignment Length:273 Identity:74/273 - (27%)
Similarity:121/273 - (44%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFIDEARTKLQYESLEGSM 289
            ||..|:...|||.|.|...||:.:.:.|:..|:..|:.|||||                   |:|
Human   163 NLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKL-------------------GNM 208

  Fly   290 ILD------------------GEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILYTM 336
            :|:                  .|.|.|.|:.|.|.|.:|::| ..:.|:|||:|||:|||:|:||
Human   209 VLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVL-SGRPYRGKPSDMWALGVVLFTM 272

  Fly   337 LVGQYPFYEKANCNLITVIRHGNVQIPL--TLSKSVRWLLLSLLRKDYTERMTASHI------FL 393
            |.||:|||:.....|...|:.....||.  .:|::...|:..||..|..:|:.|:.:      .:
Human   273 LYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVSENTVCLIRKLLVLDPQQRLAAADVLEALSAII 337

  Fly   394 TPWLREQRPFHMYLPVDVEVAEDWSDAEEDEGTAADAMDDDEEGLCPLGDKHEYEDIGVEPLDYT 458
            ..|.....     |...::|..|..|...:..::.:|...:|   |   .::|:|       :|.
Human   338 ASWQSLSS-----LSGPLQVVPDIDDQMSNADSSQEAKVTEE---C---SQYEFE-------NYM 384

  Fly   459 RSTLQMAQNANGL 471
            |..|.:|:..:.:
Human   385 RQQLLLAEEKSSI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 60/197 (30%)
STK40NP_001269475.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
STKc_SHIK 43..335 CDD:270876 60/191 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.