DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and trib2

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_012818292.1 Gene:trib2 / 394677 XenbaseID:XB-GENE-489426 Length:343 Species:Xenopus tropicalis


Alignment Length:302 Identity:109/302 - (36%)
Similarity:169/302 - (55%) Gaps:42/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SAQPS-----HISAAVAAKTPAS---------YRHLVDLTASNL-RCVDIFTGEQFLCRIVNEPL 160
            |.:||     ::.:....:||.|         |..|..|..::: |.:.:.:||:|||::     
 Frog    32 STEPSQSFSPNLGSPSPPETPNSSHCVSCIGKYLLLEPLEGNHVFRALHLHSGEEFLCKV----- 91

  Fly   161 HKVQRAYFQLQQHDEELRRS-TIYGHPLIRPVHDIIPLTKDRTYILIAPVPQERDSTGGVTGVYE 224
                   |.::.:.|.|... .:..|..|..:.:|| |.:.:.|:..     ||.        :.
 Frog    92 -------FDIRCYQETLAPCFCLPIHSNINQIAEII-LGETKAYVFF-----ERS--------HG 135

  Fly   225 NLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFIDEARTKLQYESLEGSM 289
            ::|:::|..|:|.|.:|..:|:||...|..||..||:||||||::|.|.|..|||::.|:||.:.
 Frog   136 DMHSFVRTCKKLKEEDAARLFYQIVSAVAHCHDGGIVLRDLKLRKFVFNDGERTKVKLETLEDAY 200

  Fly   290 ILDGEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILYTMLVGQYPFYEKANCNLITV 354
            :|.|.||:||||.|||.|.:||:|....:|.||.||:|||||:|||||||:|||::....:|.:.
 Frog   201 VLAGTDDSLSDKHGCPAYVSPEILNTNGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSK 265

  Fly   355 IRHGNVQIPLTLSKSVRWLLLSLLRKDYTERMTASHIFLTPW 396
            ||.|...||.|||...:.|:.|:||::.:||:|:..|...||
 Frog   266 IRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPW 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 102/268 (38%)
trib2XP_012818292.1 PK_TRB2 67..308 CDD:270924 102/267 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3556
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41445
Inparanoid 1 1.050 180 1.000 Inparanoid score I3886
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 1 1.000 - - FOG0001790
OrthoInspector 1 1.000 - - otm47965
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5302
SonicParanoid 1 1.000 - - X1487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.