DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and Stk40

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_898879.2 Gene:Stk40 / 360230 RGDID:727884 Length:435 Species:Rattus norvegicus


Alignment Length:273 Identity:74/273 - (27%)
Similarity:120/273 - (43%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFIDEARTKLQYESLEGSM 289
            ||..|:...|||.|.|...||:.:.:.|:..|:..|:.|||||                   |:|
  Rat   158 NLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKL-------------------GNM 203

  Fly   290 ILD------------------GEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILYTM 336
            :|:                  .|.|.|.|:.|.|.|.:|::| ..:.|:|||:|||:|||:|:||
  Rat   204 VLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVL-SGRPYRGKPSDMWALGVVLFTM 267

  Fly   337 LVGQYPFYEKANCNLITVIRHGNVQIPL--TLSKSVRWLLLSLLRKDYTERMTASHI------FL 393
            |.||:|||:.....|...|:.....||.  .:|::...|:..||..|..:|:.|:.:      .:
  Rat   268 LYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVSENTVCLIRKLLVLDPQQRLAAADVLEALSAII 332

  Fly   394 TPWLREQRPFHMYLPVDVEVAEDWSDAEEDEGTAADAMDDDEEGLCPLGDKHEYEDIGVEPLDYT 458
            ..|.....     |...::|..|..|......::.:|...:|   |   .::|:|       :|.
  Rat   333 ASWQSLSS-----LSGPLQVVPDIDDQMSSSDSSQEAKVTEE---C---SQYEFE-------NYM 379

  Fly   459 RSTLQMAQNANGL 471
            |..|.:|:..:.:
  Rat   380 RQQLLLAEEKSSI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 60/197 (30%)
Stk40NP_898879.2 STKc_SHIK 38..330 CDD:270876 60/191 (31%)
S_TKc 52..326 CDD:214567 60/187 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.