DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and F32D8.1

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_505770.3 Gene:F32D8.1 / 185203 WormBaseID:WBGene00009326 Length:333 Species:Caenorhabditis elegans


Alignment Length:243 Identity:64/243 - (26%)
Similarity:98/243 - (40%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DEELRRSTIYGHPLIRPVHDIIPLTKDRTYILIAPVPQERDSTGGVTGVYENLHTYIRHAKRLCE 238
            |.|:...::..|..|..:.|  ..:.:..|.::....|           |.:|:..||...|:.|
 Worm   115 DNEVEMLSLIQHDHIISIID--AFSTENQYFIVFEHAQ-----------YGDLYETIRKNGRIEE 166

  Fly   239 TEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFIDEARTKLQYESLEGSMILDGEDDTLSDKIG 303
            .:|..|..|:...:...|...::.||:|.:....:|:...||....|...::     ..|....|
 Worm   167 PDAAIITLQVASALNYLHERNVVHRDVKPENLLLVDKFSVKLCDFGLACHIL-----GPLYRICG 226

  Fly   304 CPLYTAPELLCPQQTYKGKPADMWSLGVILYTMLVGQYPFYEKANCNLITVIRHG--NVQIPLTL 366
            .|.|.|||:|  ::|......|:|||||:||.||||..||.......|..:|...  |:.:|   
 Worm   227 TPTYCAPEVL--RETGYSTRCDIWSLGVVLYVMLVGYAPFRAPDQTRLFKLIMQAKPNLDMP--- 286

  Fly   367 SKSVRWLLLSLLRKDYTERM---------TASHIFLTPWLREQRPFHM 405
                .|..:||..||...|:         .||.|...||:   .|:.|
 Worm   287 ----EWKGISLKAKDLVSRLMNKTEERRPLASQIMAHPWI---APYTM 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 61/233 (26%)
F32D8.1NP_505770.3 STKc_CAMK 70..321 CDD:270687 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.