DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and TRIB1

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_079471.1 Gene:TRIB1 / 10221 HGNCID:16891 Length:372 Species:Homo sapiens


Alignment Length:387 Identity:128/387 - (33%)
Similarity:182/387 - (47%) Gaps:88/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSSSGMSSSQEDTVLGLFT---PKKEFPNAKMLQTIREK-------------LMTPGGACDLLAL 89
            |:.||.|..:...:|...|   |.|...:|.....:..|             |..||..|     
Human     8 SAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPC----- 67

  Fly    90 GIAAEP------------TDQQPVKLIQQRYLISAQPSHISAAVAAKTPASYRHLVDLTASNLRC 142
              :.:|            :...|.::.....|..|:..|:|.|:.                    
Human    68 --SPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALC-------------------- 110

  Fly   143 VDIFTGEQFLCRIVNEPLHKVQ---RAYFQLQQHDEELRRSTIYGHPLIRPVHDIIPLTKDRTYI 204
              |.||.:..|::.  |:...|   |.|.||..|      |.|.|      :.::| |.:.:.|:
Human   111 --IHTGRELRCKVF--PIKHYQDKIRPYIQLPSH------SNITG------IVEVI-LGETKAYV 158

  Fly   205 LIAPVPQERDSTGGVTGVYENLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKR 269
            ..     |:|        :.::|:|:|..|||.|.||..:|.||...|..||::.|:|.||||::
Human   159 FF-----EKD--------FGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK 210

  Fly   270 FYFIDEARTKLQYESLEGSMILDGEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILY 334
            |.|..|.||:|:.||||.:.|:.||||.||||.|||.|.:||:|....||.||.||:|||||:||
Human   211 FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLY 275

  Fly   335 TMLVGQYPFYEKANCNLITVIRHGNVQIPLTLSKSVRWLLLSLLRKDYTERMTASHIFLTPW 396
            |:|||:|||::.....|.:.||.|...||..:|...|.|:.||||::.:||:||..|.|.||
Human   276 TLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 107/269 (40%)
TRIB1NP_079471.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..86 5/40 (13%)
PK_TRB1 97..338 CDD:270925 112/291 (38%)
COP1-binding. /evidence=ECO:0000250|UniProtKB:Q8K4K4 355..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159491
Domainoid 1 1.000 181 1.000 Domainoid score I3485
eggNOG 1 0.900 - - E33208_3BAWK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3953
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 1 1.000 - - FOG0001790
OrthoInspector 1 1.000 - - otm40776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22961
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.