DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and stk40

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001120455.1 Gene:stk40 / 100145549 XenbaseID:XB-GENE-1007328 Length:443 Species:Xenopus tropicalis


Alignment Length:275 Identity:79/275 - (28%)
Similarity:124/275 - (45%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 NLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFIDEARTKLQYESLEGSM 289
            ||..|:...|||.|.|...||:.:.:.|:..|:..|:.|||||                   |:|
 Frog   158 NLQHYVIKEKRLGERETVVIFYDVVRVVEALHKKNIVHRDLKL-------------------GNM 203

  Fly   290 ILD------------------GEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILYTM 336
            :|:                  .|||.|.|:.|.|.|.:|::| ..:.|:|||:|||:|||:|:||
 Frog   204 VLNKRTHRITVTNFCLGKHLVSEDDLLKDQRGSPAYISPDVL-SGRPYRGKPSDMWALGVVLFTM 267

  Fly   337 LVGQYPFYEKANCNLITVIRHGNVQIPL--TLSKSVRWLLLSLLRKDYTERMTASHI------FL 393
            |.||:|||:.....|...|:.....||.  .:|:|...|:..||..|..:|:|||.:      .:
 Frog   268 LYGQFPFYDSIPQELFRKIKAAEYSIPEDGRVSESTVCLIRKLLVLDPQQRLTASEVLESLGAII 332

  Fly   394 TPWLREQRPFHMYLPV----DVEVAEDWSDAEEDEGTAADAMDDDEEGLCPLGDKHEYEDIGVEP 454
            :.|   |....:..|:    |::......:::|.:.|        ||     ..::|:|      
 Frog   333 SSW---QSMSSLSGPLQVVPDIDHLTSLENSQEAKVT--------EE-----SSQYEFE------ 375

  Fly   455 LDYTRSTLQMAQNAN 469
             :|.|..|.:|:..|
 Frog   376 -NYMRQQLLLAEEKN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 64/197 (32%)
stk40NP_001120455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_SHIK 38..330 CDD:270876 64/191 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.