DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jbug and beta-Spec

DIOPT Version :9

Sequence 1:NP_001261140.1 Gene:jbug / 43997 FlyBaseID:FBgn0028371 Length:2990 Species:Drosophila melanogaster
Sequence 2:NP_001259660.1 Gene:beta-Spec / 32746 FlyBaseID:FBgn0250788 Length:2308 Species:Drosophila melanogaster


Alignment Length:265 Identity:81/265 - (30%)
Similarity:123/265 - (46%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IQANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPL-KPSWNRRPANQHHYLENA 123
            :|..||..|||.||.....::.|...|..||..|..|:|.|....| ||:..:.   :.|.|||.
  Fly    51 VQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKM---RIHCLENV 112

  Fly   124 TTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQI---------GRSKFPPRKLMLA 179
            ..||:.:....:.|.|||:.|||:||..|.|||||::|:|:||         .:.....:..:|.
  Fly   113 DKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLL 177

  Fly   180 WLQ---AALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQAMDLAQREF 241
            |.|   |...:..:.|.||.|..|:...|::...:|.|. .:..|..:.::.|...|.|:|:.:.
  Fly   178 WCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLV-QFEKLSKTNAIHNLNNAFDVAEDKL 241

  Fly   242 GVPKVLEPEYLASPWLDELSGMTYL----SYFMK------PG---GPGYNATMRWVNTQVKDPVK 293
            |:.|:|:.|.:.....||.|.:||:    .||.|      .|   |......|.  |.::....:
  Fly   242 GLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAME--NDKMVHDYE 304

  Fly   294 NFTTD 298
            |||:|
  Fly   305 NFTSD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jbugNP_001261140.1 CH 60..165 CDD:237981 42/105 (40%)
CH 172..269 CDD:278723 26/103 (25%)
CH 281..371 CDD:278723 6/18 (33%)
IG_FLMN 468..560 CDD:214720
Filamin 468..554 CDD:279024
Filamin 557..644 CDD:279024
IG_FLMN 560..648 CDD:214720
Filamin 1116..1200 CDD:279024
IG_FLMN 1119..1198 CDD:214720
Filamin 1210..1294 CDD:279024
Filamin 1299..1383 CDD:279024
IG_FLMN 1310..1389 CDD:214720
Filamin 1386..1473 CDD:279024
IG_FLMN 1399..1480 CDD:214720
Filamin 1477..1563 CDD:279024
IG_FLMN 1480..1569 CDD:214720
Filamin 1570..1653 CDD:279024
IG_FLMN 1575..1659 CDD:214720
Filamin 1657..1741 CDD:279024
IG_FLMN 1661..1747 CDD:214720
Filamin 1756..1830 CDD:279024
Filamin 1834..1919 CDD:279024
IG_FLMN 1837..1926 CDD:214720
IG_FLMN 1936..2023 CDD:214720
Filamin 1941..2017 CDD:279024
Filamin 2021..2111 CDD:279024
IG_FLMN 2025..2114 CDD:214720
Filamin 2187..2268 CDD:279024
Filamin 2279..2369 CDD:279024
IG_FLMN 2285..2375 CDD:214720
Filamin 2372..2459 CDD:279024
IG_FLMN 2376..2465 CDD:214720
IG_FLMN 2474..2561 CDD:214720
Filamin 2474..2555 CDD:279024
IG_FLMN 2657..2751 CDD:214720
Filamin 2657..2745 CDD:279024
Filamin 2755..2840 CDD:279024
IG_FLMN 2756..2847 CDD:214720
Filamin 2847..2937 CDD:279024
IG_FLMN 2850..2944 CDD:214720
beta-SpecNP_001259660.1 CH 51..149 CDD:278723 40/100 (40%)
CH 170..269 CDD:278723 26/99 (26%)
Spectrin 298..408 CDD:278843 4/12 (33%)
SPEC 422..521 CDD:197544
SPEC 525..740 CDD:238103
SPEC 639..846 CDD:238103
SPEC 848..1058 CDD:238103
SPEC 955..1169 CDD:238103
SPEC 1170..1380 CDD:238103
SPEC 1386..1484 CDD:197544
SPEC 1488..1699 CDD:238103
SPEC 1594..1806 CDD:238103
SPEC 1807..2015 CDD:238103
Spectrin 2018..>2078 CDD:278843
PH 2167..2275 CDD:278594
PH_beta_spectrin 2167..2274 CDD:269975
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.