DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and CDC14B

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_016870731.1 Gene:CDC14B / 8555 HGNCID:1719 Length:520 Species:Homo sapiens


Alignment Length:293 Identity:74/293 - (25%)
Similarity:118/293 - (40%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EKGYDLDLTY-INDNIIAMGYPAPDKLEGLFRNRLEDVF-KLLEENHAQHYKIYNL-----CSER 82
            ||..:.||.: |.|..||...|..       |.|||..: :...|.:.|::|.:|:     .::|
Human   209 EKAENGDLNWIIPDRFIAFCGPHS-------RARLESGYHQHSPETYIQYFKNHNVTTIIRLNKR 266

  Fly    83 SYDVAKFRGRVAVYPFDDH-------NPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTG 140
            .||..:|...    .||.|       :.||..:::.|..     :.|::...:|||||||.||||
Human   267 MYDAKRFTDA----GFDHHDLFFADGSTPTDAIVKEFLD-----ICENAEGAIAVHCKAGLGRTG 322

  Fly   141 TMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYV-----------QYFSKLVCSS- 193
            |:|..| :....:.:|.|.:||.    ...|.|..|..|::::           .||.:.:... 
Human   323 TLIACY-IMKHYRMTAAETIAWV----RICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQE 382

  Fly   194 -----VPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKPDRLKTLPIDFQ----- 248
                 ..:||:...|.:|..:.   |:|....|.......|......:.|||:.|....|     
Human   383 NGQHRAAFSKLLSGVDDISING---VENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNA 444

  Fly   249 -------KSFVLTIKPSIP-VSGDVKFELTKKS 273
                   :|.|.:.|.|.| :||..  .:||::
Human   445 IPLTVILQSSVQSCKTSEPNISGSA--GITKRT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 35/121 (29%)
PTEN_C2 196..335 CDD:287393 22/91 (24%)
CDC14BXP_016870731.1 CDC14_N 52..190 CDD:350495
CDC14_C 199..372 CDD:350349 50/183 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.