DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and Dusp11

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_082375.4 Gene:Dusp11 / 72102 MGIID:1919352 Length:321 Species:Mus musculus


Alignment Length:142 Identity:35/142 - (24%)
Similarity:67/142 - (47%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DVFKLLEENHAQ------------HYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRF 112
            |:|..::|.:.:            :||:.:|....||        :.::.. .|..|..:.|.:|
Mouse    74 DLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPETISY--------IKIFTV-GHQIPDNDTIFQF 129

  Fly   113 CSDVDMWLKEDSSN--VVAVHCKAGKGRTGTMICAYLV-FSGIKKSADEALAWYDEKRTK--DRK 172
            ...|..:||::.:|  ::.|||..|..|||.:||.||: ..|::  .|:|:..::..|..  :|:
Mouse   130 KCAVKEFLKKNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMR--PDDAIELFNSCRGHCIERQ 192

  Fly   173 GVTIPSQRRYVQ 184
            ......|:|:|:
Mouse   193 NYIENLQKRHVR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 30/121 (25%)
PTEN_C2 196..335 CDD:287393
Dusp11NP_082375.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PTPc <119..195 CDD:304379 23/77 (30%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75319 152..157 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..262 35/142 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.