DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and TPTE

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_954870.3 Gene:TPTE / 7179 HGNCID:12023 Length:551 Species:Homo sapiens


Alignment Length:367 Identity:115/367 - (31%)
Similarity:192/367 - (52%) Gaps:62/367 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQH 72
            :..:||..||:.:.||...|:||||||:.:.||||.:|:..: :..:||.:::|.:.|::.|..|
Human   215 LEKLIRRRVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGR-QSFYRNPIKEVVRFLDKKHRNH 278

  Fly    73 YKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKG 137
            |::|||||||:||...|..||.....||||.||:..:..|..:|:.|:.:|..|:||:|||.|..
Human   279 YRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTD 343

  Fly   138 RTGTMICAYLVFSGIKKSADEALAWYDEKRTKDR------KGVTIPSQRRYVQYFSKL------- 189
            |||||:||:|:.|.|..:|.|:|.::.|:|| |:      :||..|||:|||.||:::       
Human   344 RTGTMVCAFLIASEICSTAKESLYYFGERRT-DKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWN 407

  Fly   190 ------------VCSSVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKPDRLKT 242
                        :..|:|.....|.: :|...:......:.:.:||:       .:|...|::  
Human   408 LPPRRILFIKHFIIYSIPRYVRDLKI-QIEMEKKVVFSTISLGKCSV-------LDNITTDKI-- 462

  Fly   243 LPIDFQKSFVLTIKPSIPVSGDVKFELTKKS-P---DKIICHFWLNTFFVRNYSPCESDGTVNKY 303
                     ::.:...:|:..|||.:....: |   |....:|||:|.|:.|          |:.
Human   463 ---------LIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIEN----------NRL 508

  Fly   304 IHTLSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSNDVQA 345
            .  |.|:|:|::||....:.:..:|.:.|:|..:..|:||.|
Human   509 Y--LPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVA 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 48/108 (44%)
PTEN_C2 196..335 CDD:287393 27/142 (19%)
TPTENP_954870.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTP_VSP_TPTE 224..400 CDD:350360 78/177 (44%)
PTEN_C2 409..539 CDD:402161 30/160 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8613
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100936
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X965
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.