DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and AgaP_AGAP010093

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_553994.2 Gene:AgaP_AGAP010093 / 4578379 VectorBaseID:AGAP010093 Length:263 Species:Anopheles gambiae


Alignment Length:105 Identity:25/105 - (23%)
Similarity:42/105 - (40%) Gaps:27/105 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SSVPYSKVSLNVCEIRFSES-SCV--QNLGMVECSISVLHDSATENAKPDRLKTLPIDFQKSFVL 253
            :.||..:..|.:.:||.|.: :|:  .:||::|         ||...|...|...|.|...|.| 
Mosquito   174 NDVPVGRNVLELTDIRVSTNYTCIAQSSLGVIE---------ATSLVKVQSLPAAPTDVTISEV- 228

  Fly   254 TIKPSIPVSGDVKFELTKKSPDKIICHFWLNTFFVRNYSP 293
                   .:..|:.|.:.|.|:.:       .::|..|.|
Mosquito   229 -------TATQVRLEWSYKGPEDL-------QYYVIQYKP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379
PTEN_C2 196..335 CDD:287393 23/101 (23%)
AgaP_AGAP010093XP_553994.2 Ig <88..122 CDD:299845
I-set 128..213 CDD:254352 12/47 (26%)
Ig 143..212 CDD:299845 12/46 (26%)
fn3 219..>259 CDD:278470 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.