DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and Tpte2

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_038950660.1 Gene:Tpte2 / 364629 RGDID:1305825 Length:674 Species:Rattus norvegicus


Alignment Length:359 Identity:122/359 - (33%)
Similarity:185/359 - (51%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQH 72
            :..:.|.:||..:.|||:.|:||||||:.:.||||.:|:..: |..:||.:::|.:.|:..|..|
  Rat   339 LEKLTRQLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGR-ESFYRNPIKEVVRFLDTKHPNH 402

  Fly    73 YKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKG 137
            |::||||||||||..:|..||.....||||.||:|.:..|..:|:.|:.:|..||||:|||.|||
  Rat   403 YQVYNLCSERSYDPKRFHYRVRRIMIDDHNVPTLEEMLLFSKEVNDWMAQDPENVVAIHCKGGKG 467

  Fly   138 RTGTMICAYLVFSGIKKSADEALAWYDEKRTKDR------KGVTIPSQRRYVQYFSKLVCS---S 193
            |||||:||.|:.|.|..:|..:|.::.|:|| |:      :||..|||.|||:||.||..|   :
  Rat   468 RTGTMVCACLIASEIVLNAKASLYFFGERRT-DKSNSSKFQGVETPSQNRYVKYFEKLKTSYQLT 531

  Fly   194 VPYSKV--------------------SLNVCEIRFSES--SCVQNLGMVECSISVLHDSATENAK 236
            :|..||                    .|.:..:.:.|:  ||..:...:     :.||..|:...
  Rat   532 LPPKKVLVIKRFTVYSIHGVGKGNGSDLEIQIMMWQETIFSCFNSKNCM-----IFHDVETDKVI 591

  Fly   237 PDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKSPDKIICHFWLNTFFVRNYSPCESDGTVN 301
            .: :...|..:....|..:.|::|           |..|.....||.:|.|:||          |
  Rat   592 IN-VFNCPALYDDVKVKFLCPNLP-----------KYYDDCPFFFWFHTSFIRN----------N 634

  Fly   302 KYIHTLSKSEIDDVHKDSEHKRFSEEFKISIVFE 335
            :..  |.:||:|:.||....|.:..:|.:.:.||
  Rat   635 RLY--LPRSELDNTHKQKTWKIYGPKFAVEVYFE 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 52/108 (48%)
PTEN_C2 196..335 CDD:287393 30/160 (19%)
Tpte2XP_038950660.1 PTP_VSP_TPTE 348..524 CDD:350360 84/177 (47%)
PTEN_C2 533..667 CDD:402161 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8521
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100936
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X965
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.