DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and Ptprd

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_038967340.1 Gene:Ptprd / 313278 RGDID:1561090 Length:1940 Species:Rattus norvegicus


Alignment Length:370 Identity:72/370 - (19%)
Similarity:125/370 - (33%) Gaps:135/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YKIYNLCSERSYDVAKFRGRVAVYP---FDDHNPPTIELIQRF--CSDVDMWLKEDSSNVVAVHC 132
            :.:|...|....:|.:|  :...:|   ..:|..|.:..::|.  |:..|       :..:.|||
  Rat  1526 FALYKNGSSEKREVRQF--QFTAWPDHGVPEHPTPFLAFLRRVKTCNPPD-------AGPMVVHC 1581

  Fly   133 KAGKGRTGTMICAYLVFSGIK--KSAD------------------------------EA------ 159
            .||.||||..|....:...||  |:.|                              ||      
  Rat  1582 SAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNT 1646

  Fly   160 ------LAWYDEKRTKDRKGVTIPSQ----RRYVQ---YFSKLVCSSVPYSKVSLNVCEIRFSES 211
                  |..|.:|.|:...|..:...    :|...   :.|:.:.:::|.:|....:..|...||
  Rat  1647 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYES 1711

  Fly   212 S--CVQNLGMVECSISVLHDSATENAKPDRLKTLPID---FQKSFVLTIKPSIPVSGD------- 264
            :  |:|.:..||.|              |.:....:|   .||:::.|..|....:.|       
  Rat  1712 TRVCLQPIRGVEGS--------------DYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWE 1762

  Fly   265 ----VKFELTK-KSPDKIICH-FW--------------------LNTFFVRNYSPCES-DG---T 299
                :...||| :...:..|| :|                    :..:.:|.:...:: ||   |
  Rat  1763 HNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRT 1827

  Fly   300 VNKYIHT------LSKSE------IDDVHKDSEHKRFSEEFKISI 332
            |.::..|      :.||.      |..|||..|  :|.::..||:
  Rat  1828 VRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE--QFGQDGPISV 1870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 28/142 (20%)
PTEN_C2 196..335 CDD:287393 38/191 (20%)
PtprdXP_038967340.1 I-set 31..123 CDD:400151
Ig strand A' 39..43 CDD:409353
Ig strand B 46..55 CDD:409353
Ig strand C 61..66 CDD:409353
Ig strand C' 69..72 CDD:409353
Ig strand D 75..83 CDD:409353
Ig strand E 84..94 CDD:409353
Ig strand F 102..110 CDD:409353
Ig strand G 113..123 CDD:409353
IgI_2_RPTP_IIa_LAR_like 135..234 CDD:409400
Ig strand B 151..155 CDD:409400
Ig strand C 164..168 CDD:409400
Ig strand E 198..202 CDD:409400
Ig strand F 212..217 CDD:409400
Ig strand G 224..227 CDD:409400
IgI_3_RPTP_IIa_LAR_like 247..328 CDD:409401
Ig strand B 261..265 CDD:409401
Ig strand C 274..278 CDD:409401
Ig strand E 295..299 CDD:409401
Ig strand F 307..312 CDD:409401
Ig strand G 320..323 CDD:409401
FN3 331..420 CDD:238020
FN3 427..519 CDD:238020
FN3 524..612 CDD:238020
FN3 620..714 CDD:238020
fn3 721..820 CDD:394996
FN3 832..927 CDD:238020
FN3 930..1021 CDD:238020
FN3 1031..>1092 CDD:238020
R-PTPc-D-1 1362..1645 CDD:350472 26/127 (20%)
R-PTP-D-2 1646..1937 CDD:350476 46/241 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.