DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and Dusp11

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001020821.1 Gene:Dusp11 / 297412 RGDID:1307038 Length:326 Species:Rattus norvegicus


Alignment Length:193 Identity:46/193 - (23%)
Similarity:77/193 - (39%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DVFKLLEENHAQ------------HYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRF 112
            |:|..::|.:.:            :||:.:|....||......|         |..|....|.:|
  Rat    73 DLFNKIQEQNEELGLIIDLTYTQRYYKVEDLPKTISYIKILTVG---------HQVPDSGTIFQF 128

  Fly   113 CSDVDMWLKEDSSN--VVAVHCKAGKGRTGTMICAYLV-FSGIKKSADEALAWYDEKRTKDRKGV 174
            .|.|..:||.:.:|  ::.|||..|..|||.:||.||: ..|::  .|:|:..::..|     |.
  Rat   129 KSAVKEFLKRNKNNDKLIGVHCTHGLNRTGYLICRYLIDVEGMR--PDDAIELFNRCR-----GH 186

  Fly   175 TIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKP 237
            .|..| .|::...|.               .:|.::::.....|.:|.|..:.....|.| ||
  Rat   187 CIERQ-NYIENLQKR---------------RVRKNQNASASRSGGLEDSAHLTEQVHTTN-KP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 32/121 (26%)
PTEN_C2 196..335 CDD:287393 8/42 (19%)
Dusp11NP_001020821.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PTPc 77..194 CDD:304379 34/133 (26%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75319 151..156 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..258 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.