DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and ZK484.7

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_491758.1 Gene:ZK484.7 / 191327 WormBaseID:WBGene00022753 Length:344 Species:Caenorhabditis elegans


Alignment Length:119 Identity:23/119 - (19%)
Similarity:52/119 - (43%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DHNPPTIELIQRFCSDVDMWLK-EDSSNVVAVHCKAGKGRTGTMICAYLVFSGIK-----KSADE 158
            |...||.::     :.|::..| ..|.....|||.||.||||:::....:...:.     :..|:
 Worm   229 DRGVPTADM-----AIVELLAKTRPSKGPTVVHCSAGIGRTGSVVMIEYILDQLLGGQQIEETDK 288

  Fly   159 ALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLV--CSSVPYSKVSLNVCEIRFSE 210
            .|     ::.::::..:|.:.::|:.....::  |.......|.:.:..:.|:|
 Worm   289 IL-----QKIREQRNNSIQTDQQYLFVHQVILN
YCLDKKMFDVDVKLAHLAFTE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 17/72 (24%)
PTEN_C2 196..335 CDD:287393 3/15 (20%)
ZK484.7NP_491758.1 Y_phosphatase 80..316 CDD:278528 19/96 (20%)
PTPc 81..316 CDD:238006 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.