powered by:
Protein Alignment Pten and pir-1
DIOPT Version :9
Sequence 1: | NP_001162933.1 |
Gene: | Pten / 43991 |
FlyBaseID: | FBgn0026379 |
Length: | 514 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495959.2 |
Gene: | pir-1 / 174460 |
WormBaseID: | WBGene00011967 |
Length: | 233 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 36/63 - (57%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 ELIQRFCSDVDMWL--KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKR 167
:|:|.|.:.|..:: ||:...::.|||..|..|||.:||.|:: .....||.:|::.::..|
Worm 123 DLVQDFINAVKEFVNDKENDGKLIGVHCTHGLNRTGYLICRYMI-DVDNYSASDAISMFEYYR 184
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pten | NP_001162933.1 |
PTPc |
58..167 |
CDD:304379 |
19/61 (31%) |
PTEN_C2 |
196..335 |
CDD:287393 |
|
pir-1 | NP_495959.2 |
DSPc |
65..201 |
CDD:307089 |
20/63 (32%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.