DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and pir-1

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_495959.2 Gene:pir-1 / 174460 WormBaseID:WBGene00011967 Length:233 Species:Caenorhabditis elegans


Alignment Length:63 Identity:20/63 - (31%)
Similarity:36/63 - (57%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ELIQRFCSDVDMWL--KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKR 167
            :|:|.|.:.|..::  ||:...::.|||..|..|||.:||.|:: .....||.:|::.::..|
 Worm   123 DLVQDFINAVKEFVNDKENDGKLIGVHCTHGLNRTGYLICRYMI-DVDNYSASDAISMFEYYR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 19/61 (31%)
PTEN_C2 196..335 CDD:287393
pir-1NP_495959.2 DSPc 65..201 CDD:307089 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.