DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and W03F11.4

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_490945.2 Gene:W03F11.4 / 171780 WormBaseID:WBGene00021007 Length:1371 Species:Caenorhabditis elegans


Alignment Length:450 Identity:91/450 - (20%)
Similarity:145/450 - (32%) Gaps:154/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLF-RNRLEDVFKLLEEN-----HAQ 71
            |..|..:..::||.|         :|..|..|....|.|..| |..::.|  .:|||     ..|
 Worm  1053 RTGVVAQLCQFKEDG---------ENKCAEYYSTEVKGEMKFGRYTVKTV--SVEENLDQFTDKQ 1106

  Fly    72 HYKIYNLCSERSYDVAKFRGRVAVYPFD---DHNPP-----TIELIQRFCSDVDMWLKEDSSNVV 128
            ..|:|.:....:..:.|....|.:..|.   ||..|     .:::| ::|        |.....|
 Worm  1107 TAKVYTIEFHNNKVLMKVPFPVKILAFSGWPDHGAPAEPHTALDII-KYC--------ESFKTNV 1162

  Fly   129 AVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSS 193
            .|||..|.|||||::.                                      ::|..:| ||.
 Worm  1163 LVHCSVGVGRTGTLVA--------------------------------------IKYGIQL-CSK 1188

  Fly   194 VPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPS 258
            ...|.::|.|..:|......||                ||.             |..::|..   
 Worm  1189 QEVSDMALVVDPVRACRYGAVQ----------------TEQ-------------QLIYMLLC--- 1221

  Fly   259 IPVSGDVKFELTKKSPDKIICHFWLNTFFVR-NYSPCESDGTVNKYIHTLSKSEIDDVHKDSEHK 322
                      :||...:|....||.|...:. .|...::|    .|...|.|.|.|.....::.|
 Worm  1222 ----------ITKALMEKAGVLFWDNYNALHYYYDKLQTD----YYEPYLKKDEKDPELLAAKKK 1272

  Fly   323 RFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFERSDYDSLSPNCYAEKKVLTAIVNDNTT 387
            :|.|:            .|:::....||          |.::|..:|. |.||:.....:.||..
 Worm  1273 KFKED------------GNNLEEYLGEK----------RKEFDEKNPG-YREKQQKDKALWDNDV 1314

  Fly   388 KSQTIETLDHKDIVTKIQYDTSTNSKNTS---TACKRKQPNSKTLLPSLNDSTKEEIKRN 444
            ..:..|....::.:.|||.:.:...|:..   ...||:....|        ..|||.|::
 Worm  1315 NKEYEERQKFQEQLKKIQKENAKKPKSEDRPRRGDKRRGAAKK--------DVKEEDKKS 1366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 26/121 (21%)
PTEN_C2 196..335 CDD:287393 26/139 (19%)
W03F11.4NP_490945.2 WSN 47..113 CDD:197734
PTPc 966..1222 CDD:238006 52/269 (19%)
Y_phosphatase 966..1222 CDD:278528 52/269 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.