DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and AgaP_AGAP003715

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_310244.7 Gene:AgaP_AGAP003715 / 1271448 VectorBaseID:AGAP003715 Length:1287 Species:Anopheles gambiae


Alignment Length:407 Identity:97/407 - (23%)
Similarity:164/407 - (40%) Gaps:97/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-LEGLFR-NRLEDVFKLLEENHAQ 71
            |:.:...|.:..:|     .|||::||...|:.|  |.|.: :|..:| |.::|| ||..::..|
Mosquito   447 SSKVMQTVQQSIVR-----TDLDMSYITQRILVM--PCPSEGIESAYRTNNIDDV-KLFLDSRYQ 503

  Fly    72 HYK--IYNLCSE----------RSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDS 124
            ..|  :|||...          |:.|....   .|..|......|.:..:.....|:..:|..|.
Mosquito   504 PTKLSVYNLVGRNGCPRLPPPVRTVDAGFI---YAPAPQQGGKAPVLTGLYSLVEDIYGFLSADP 565

  Fly   125 SNVVAVHC-KAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSK 188
            ..||.|.. ..|:....|::||.||::.:....::|:..:..|||.....   ||:.||:.|...
Mosquito   566 KTVVIVQSPDGGRALAATVVCALLVYASLVTEPEDAMQMFAIKRTPPNMR---PSELRYLYYLGD 627

  Fly   189 LVCSSVPY-------SKVSLNVCEI-RFSESSCVQNLGMVECSISVLHDSATENAKPDRLKTLPI 245
            :| .|||:       :.|||.|..: |.:::       ...|.:.|      |.|..||.....:
Mosquito   628 IV-RSVPHLPHYKPVTLVSLAVTPVPRMTKA-------RDGCRMYV------EVATADRTVFCTL 678

  Fly   246 -DFQKSFV-------LTIKPSIPVSGDVKFELTKK--------SPDKI-ICHFWLNTFFVRNYSP 293
             |:::..:       :.:..::.|.|||...|...        .|..: ||....:|.|:.    
Mosquito   679 QDYERMRLYHTSEGKIALAMNVTVCGDVTISLYHARNALGGMGRPQGLKICQLQFHTGFIP---- 739

  Fly   294 CESDGTVNKYIHTLSKSEIDDVHKDSEHKRFSEEFKISI-VFEAEN--------------FSNDV 343
             |.:..:|     ..::|:|:| .|.||  ..::|.::: ||..::              .|.|.
Mosquito   740 -EEETLIN-----YDRAELDEV-PDLEH--VPQKFSVALSVFVGDSERPPATQPPWRTPKASRDP 795

  Fly   344 QA-EASEKERNENVLNF 359
            :. .||:.|..|||.||
Mosquito   796 RTLFASQLEYEENVDNF 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 27/121 (22%)
PTEN_C2 196..335 CDD:287393 32/164 (20%)
AgaP_AGAP003715XP_310244.7 PKc_like 35..314 CDD:304357
S_TKc 37..305 CDD:214567
YppG <381..460 CDD:290883 2/12 (17%)
PTEN_C2 636..767 CDD:287393 31/156 (20%)
Rox3 <1071..1126 CDD:285797
DnaJ <1232..1272 CDD:197617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.