DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and LOC108645586

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_017946241.2 Gene:LOC108645586 / 108645586 -ID:- Length:367 Species:Xenopus tropicalis


Alignment Length:406 Identity:75/406 - (18%)
Similarity:138/406 - (33%) Gaps:145/406 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTISLMS----NVIRNV-------------VSKKRI----RYKEKGYDLDLTYINDNIIAMGYPA 46
            ||:.:::    |:.:|:             ||::.|    .|.:||. .|:|:..          
 Frog    16 NTVRILAADPLNLEKNLAFIVQVILEEFGRVSRREILAIQDYPKKGI-YDVTFDG---------- 69

  Fly    47 PDKLEGLFRNRLEDVFKLLEEN----HAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIE 107
                ||:||:.|    .:||.|    ....:||:...::..:.|.|     :..||         
 Frog    70 ----EGVFRSFL----SILEANSGDPRLSGFKIFPHITDEVFLVVK-----SYSPF--------- 112

  Fly   108 LIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKD-- 170
                      :.|||..| |:..:||.            |.|.|  |..:|...|..:.|.|.  
 Frog   113 ----------VPLKEIES-VLGRYCKK------------LSFVG--KILNELGIWTLKYRFKAIF 152

  Fly   171 RKGVTIPSQRRYVQYFSKLVCSSVP--------YSKV---------------------SLNVCEI 206
            ::|:..|::.|..........|.:|        |..:                     |...|..
 Frog   153 KEGLFPPARFRLGTVNIDCFFSGMPDFCRRCRQYGHIADGCSLCQGCGKAGHEITNCSSPKKCNF 217

  Fly   207 RFSE----SSCVQNLGMVECSISVLHDS---ATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGD 264
            .|.|    ::|.......|.::::...|   |...:||...:.:.....:|.....:.......|
 Frog   218 CFQEGHLYATCPTRKVSSEETVAIPGKSSVQAESASKPHEEEDITDQASQSGPKVKRSKEKKERD 282

  Fly   265 VKFELTKKSPDKIICHFWLNTFFVRNYSPCESDGTVNKYIHTLSKSE-IDDVHKDSEHKRFSEEF 328
            .:.:..|::||               .||  |..:::.::.::|:.| :.:.:||..:|..||  
 Frog   283 KEKKRRKETPD---------------VSP--SGDSLDSFLDSISRGERLYEAYKDKTNKEISE-- 328

  Fly   329 KISIVFEAENFSNDVQ 344
                :.||.:...:.|
 Frog   329 ----ILEAWSDEEEFQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379 23/112 (21%)
PTEN_C2 196..335 CDD:287393 26/167 (16%)
LOC108645586XP_017946241.2 AIR1 <179..>232 CDD:227414 6/52 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.