DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and yeats2

DIOPT Version :9

Sequence 1:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_012825478.1 Gene:yeats2 / 100135359 XenbaseID:XB-GENE-5865259 Length:1238 Species:Xenopus tropicalis


Alignment Length:226 Identity:49/226 - (21%)
Similarity:88/226 - (38%) Gaps:44/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 EIDDVHKDSEHK------RFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFER-------- 361
            :|..||::..||      |.:...||..:.: |.|..:::.:..|.|..:..||..|        
 Frog    17 DISVVHQNKRHKAAETTARDATILKIESIIK-EQFVTELKNKEHEVEVIDQRLNEARRMMDKLRA 80

  Fly   362 -------------------SDYDSLSPNCYAEKKVLTAIVNDNTTKSQTIETLDHKDIVTKIQY- 406
                               |.||:...|..:.||.|.:....::..:|..||....:..|...| 
 Frog    81 CIVANYYASAALNKNQEGPSSYDATVLNHPSIKKFLESPSRASSPANQRSETPSVANSETDSVYT 145

  Fly   407 -----DTSTNSKNTSTACKRKQPNSKTLL-PSLNDSTKEEIKRNHIFNQPSIKKTDLIKWQNSEV 465
                 |.|.::|..: |.|..:|...|:. ||:|::|:.::.|.....:..:|||.::  .|...
 Frog   146 HNEDKDGSLDAKGPA-ANKALRPEGNTVKDPSINENTERQVSRTEDGPRRFVKKTIVV--GNVSK 207

  Fly   466 HITSDTRSINENKNINYNSYITCKQSSPKFN 496
            :|..|.|..|:.....:..|:...:..|..:
 Frog   208 YIPPDKREENDQSTHKWMVYVRGSRKEPSID 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_001162933.1 PTPc 58..167 CDD:304379
PTEN_C2 196..335 CDD:287393 8/29 (28%)
yeats2XP_012825478.1 YEATS 221..300 CDD:281374 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.