DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and SEPTIN7

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_011513958.1 Gene:SEPTIN7 / 989 HGNCID:1717 Length:460 Species:Homo sapiens


Alignment Length:410 Identity:160/410 - (39%)
Similarity:250/410 - (60%) Gaps:35/410 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKKTQEVATKVPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSF 71
            |:::...:|.|.:...|.|:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..
Human    11 EERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDL 75

  Fly    72 GST--PSP-HNL-PNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEA 132
            .|.  |.| |.: ..|:::.:...::|..|:|.||:.||.|:||.|:.::.::.:::|:||:||.
Human    76 YSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFED 140

  Fly   133 YLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSE 197
            ||..|.::.|....  |.||..|||||.|:|||||.:|:..||:|..:|||||:||||||::..|
Human   141 YLNAESRVNRRQMP--DNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEE 203

  Fly   198 LSGFKERIMDELRRNNVSIYQFP-MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYP 261
            ...||::||.|::.:.:.||:|| .|||..::....:...||.|||||...::|.||:||.||||
Human   204 CQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYP 268

  Fly   262 WGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSN-------- 318
            ||...:||..||||..||.|||||:|:||::.|:..|||.:|.|:|..:.:..||:|        
Human   269 WGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTK 333

  Fly   319 ----------NQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFD 373
                      ..|::   ..|.:|.:|:|.::..|.|:.|:|..:||:|..:|||:|.|      
Human   334 HLMITLNIRDRSPLA---QMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAE------ 389

  Fly   374 RLKREHLEEKAQLEEARRQL 393
             ::|..|..:..|::.|.::
Human   390 -VQRTFLASEKGLQKKRHRV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 156/392 (40%)
CDC_Septin 43..311 CDD:206649 122/272 (45%)
BAR <252..405 CDD:299863 57/160 (36%)
SEPTIN7XP_011513958.1 CDC3 29..419 CDD:227352 156/392 (40%)
CDC_Septin 47..317 CDD:206649 122/271 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.