DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and CDC3

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_013418.2 Gene:CDC3 / 851024 SGDID:S000004306 Length:520 Species:Saccharomyces cerevisiae


Alignment Length:411 Identity:149/411 - (36%)
Similarity:236/411 - (57%) Gaps:47/411 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNT----------------- 69
            |:.|:|||..||.|...:|::||||||:||:|...:||:|||.||||.                 
Yeast    95 QINGYVGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELAN 159

  Fly    70 ---------SFGSTPSPHNLPNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNK-ADSYKALVE 124
                     ......|......||:|:....::|:.|:|.|.|.||.|:||.:|. ..|:..:::
Yeast   160 DQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIK 224

  Fly   125 YVDSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAK 189
            .:||:|:.||..|.||.|  .|.:|.|:|||||||.||||.||.:||..|:.:..:.|:||||||
Yeast   225 EIDSRFDQYLDAENKINR--HSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAK 287

  Fly   190 ADTISKSELSGFKERIMDELRRNNVSIYQFPM---DDETVSETNAAMNGHLPFAVVGSTEFVK-V 250
            :|.::..|:..||:.||::|.::|:.:::.|:   ||...|..:..:...||:||:||.:.|: .
Yeast   288 SDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDDAENSHLSERLFSSLPYAVIGSNDIVENY 352

  Fly   251 AGKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMG---- 311
            :|.|||.|.||||.:.::|:.|.||..|:.:||:..||:|:|:|....||.:|..:|.::|    
Yeast   353 SGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYRSSKLAKLGIKQD 417

  Fly   312 ---FVDVDSNNQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFD 373
               |.:.|    |:|.||   .:::.|.|.|...|.|::.:|.|:|.:||.:|:.:|.||..:..
Yeast   418 NSVFKEFD----PISKQQ---EEKTLHEAKLAKLEIEMKTVFQQKVSEKEKKLQKSETELFARHK 475

  Fly   374 RLKREHLEEKAQLEEARRQLE 394
            .:|.:..::...||:.::|||
Yeast   476 EMKEKLTKQLKALEDKKKQLE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 146/406 (36%)
CDC_Septin 43..311 CDD:206649 113/298 (38%)
BAR <252..405 CDD:299863 52/150 (35%)
CDC3NP_013418.2 CDC3 97..503 CDD:227352 148/409 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18884
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.