DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and CDC10

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_009928.1 Gene:CDC10 / 850358 SGDID:S000000595 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:329 Identity:122/329 - (37%)
Similarity:194/329 - (58%) Gaps:31/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLF-----NTSFGSTPSPHNL 80
            :|...:|||||:.:|:.::.::.||.|||:.:|::.||||||::|||     :::.|...|.  |
Yeast     7 VQPASYVGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISA--L 69

  Fly    81 PNVK---LKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQR 142
            |..|   :|.:|:.|.|..|||.:.|.||.|:||.::.:.:::.:|:|:..|...||::||..||
Yeast    70 PVTKTTEMKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQR 134

  Fly   143 AMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMD 207
            ..... |.||||.|||:.|.|..|..:|:..:|:|....|:||||.|:||::..|.:.|:|.|.:
Yeast   135 ERFIT-DTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGKSDTLTLDERTEFRELIQN 198

  Fly   208 ELRRNNVSIYQFPMDDETVS----ETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIE 268
            |..:.|..||  |.|.|.::    |.|.::...:|||||||...:::.|:..|.|:..|.|:::|
Yeast   199 EFEKYNFKIY--PYDSEELTDEELELNRSVRSIIPFAVVGSENEIEINGETFRGRKTRWSAINVE 261

  Fly   269 NEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRS 333
            :...||||.|||.||||:::||.|.|...|||.||.|:|              ::.::...|:.|
Yeast   262 DINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQL--------------IALKENANSRSS 312

  Fly   334 DHLA 337
            .|::
Yeast   313 AHMS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 121/325 (37%)
CDC_Septin 43..311 CDD:206649 112/279 (40%)
BAR <252..405 CDD:299863 31/86 (36%)
CDC10NP_009928.1 CDC3 11..322 CDD:227352 121/325 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51948
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.