DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin9

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038942878.1 Gene:Septin9 / 83788 RGDID:708523 Length:583 Species:Rattus norvegicus


Alignment Length:295 Identity:120/295 - (40%)
Similarity:191/295 - (64%) Gaps:14/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTP----SPHNLP-NVK 84
            |:||.|::.:|:..|:::.||.|||:.:|::.||||||::|||.:......    |...:| .::
  Rat   275 GYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPISEERIPKTIE 339

  Fly    85 LKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHD 149
            :|:.|::::|..||:||||.||.|:||.:|..:.::.::::::.|:|.|||||:.|.| .....|
  Rat   340 IKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINR-KKRIPD 403

  Fly   150 GRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNV 214
            .|||.|||||..|||.|:.:|:..||:|...|||:||||||||::..|...||:||..:|..|.:
  Rat   404 TRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVYFKQRITSDLLSNGI 468

  Fly   215 SIY---QFPMD--DETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCD 274
            .:|   :|..|  |..|:|....|   :|||||||....:|.||::..|:..||.:.:||..||:
  Rat   469 DVYPQKEFDEDAEDRLVNEKFREM---IPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE 530

  Fly   275 FVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQ 309
            |..||::||||:|:::::.|...|:|.:|.:||.:
  Rat   531 FAYLRDLLIRTHMQNIKDITSNIHFEAYRVKRLNE 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 120/295 (41%)
CDC_Septin 43..311 CDD:206649 114/277 (41%)
BAR <252..405 CDD:299863 23/58 (40%)
Septin9XP_038942878.1 PHA03247 <38..232 CDD:223021
CDC_Septin 293..567 CDD:206649 114/277 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.