DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and TOC120

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_188284.1 Gene:TOC120 / 820913 AraportID:AT3G16620 Length:1089 Species:Arabidopsis thaliana


Alignment Length:523 Identity:95/523 - (18%)
Similarity:174/523 - (33%) Gaps:217/523 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLVTEKKTQEVATKVPRLL-----------------------QLGGHVG-------FD---TLPD 34
            |..|.:|.|.:..|..||.                       ||.|..|       ||   .:.:
plant   379 HDETREKLQFIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQLRGRNGSRVGAFSFDRASAMAE 443

  Fly    35 QLVNKSVQN--GFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNLPNVKLKANTYELQESNV 97
            || ..:.|:  .||..|:.:|::.:|||..::::|:             .:|:..:.:::....|
plant   444 QL-EAAAQDPLDFSCTIMVLGKSGVGKSATINSIFD-------------ELKISTDAFQVGTKKV 494

  Fly    98 R--------LKLTVCDTIG----YGDQVNKAD----SYKALVEYVDSQFEAYLQE---------E 137
            :        :|:.|.||.|    :.|| :|.:    |.:|.::........||..         :
plant   495 QDIEGFVQGIKVRVIDTPGLLPSWSDQ-HKNEKILKSVRAFIKKSPPDIVLYLDRLDMQSRDSGD 558

  Fly   138 LKIQRAMA---------SAHDGRVHACL--------------YFICPTGHGLKAMDLVCMKQLDT 179
            :.:.|.:.         :|..|..||..              .|:....|               
plant   559 MPLLRTITDVFGPSIWFNAIVGLTHAASAPPDGPNGTASSYDMFVTQRSH--------------- 608

  Fly   180 RVNIIPVIAKADTISKSELSGFKERIMDELRRNNVSIYQFPMDDETVSETNAAMNGHLPFAVVGS 244
                  ||.:|...:..::     |:|     |.||:    :::.:...||.|....||...|..
plant   609 ------VIQQAIRQAAGDM-----RLM-----NPVSL----VENHSACRTNRAGQRVLPNGQVWK 653

  Fly   245 TEFVKVAGKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQ 309
            ...:.::           .|..|..||:. .:||::     |:...:..|.::...|        
plant   654 PHLLLLS-----------FASKILAEANA-LLKLQD-----NIPGGQFATRSKAPPL-------- 693

  Fly   310 MGFVDVDSNNQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENEL---KDNEKELHTK 371
                       |:......:|:....|...|..:|:           .|::|   .|:|:|  ::
plant   694 -----------PLLLSSLLQSRPQAKLPEQQYDDED-----------DEDDLDESSDSEEE--SE 734

  Fly   372 FDRL------------------KREHLEEKAQLEE--ARRQLEEDCQELQRRRL---------QM 407
            :|.|                  |:|:|:|....|:  .:||::|   |.:||:|         .|
plant   735 YDELPPFKRLTKAEMTKLSKSQKKEYLDEMEYREKLFMKRQMKE---ERKRRKLLKKFAAEIKDM 796

  Fly   408 ANG 410
            .||
plant   797 PNG 799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 78/451 (17%)
CDC_Septin 43..311 CDD:206649 52/317 (16%)
BAR <252..405 CDD:299863 32/175 (18%)
TOC120NP_188284.1 MDN1 <13..386 CDD:227596 2/6 (33%)
3a0901s04IAP86 333..1088 CDD:273381 95/523 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.