DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and TOC132

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001324729.1 Gene:TOC132 / 816165 AraportID:AT2G16640 Length:1206 Species:Arabidopsis thaliana


Alignment Length:477 Identity:91/477 - (19%)
Similarity:161/477 - (33%) Gaps:160/477 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLVTEKKTQEVATKVPRLLQLGGHVGFDTLPDQLV------------NKSVQNGFSFN------- 48
            |..|.:|.|.:..|..||....|....:.:..|::            |.|....|||:       
plant   497 HDETREKLQLIRVKFLRLAHRLGQTPHNVVVAQVLYRLGLAEQLRGRNGSRVGAFSFDRASAMAE 561

  Fly    49 ---------------ILCIGETALGKSTLMDTLFNTSFGSTPSPHNLPNVKLKANTYELQESNVR 98
                           |:.:|::.:|||..::::|:             .||...:.:::....|:
plant   562 QLEAAGQDPLDFSCTIMVLGKSGVGKSATINSIFD-------------EVKFCTDAFQMGTKRVQ 613

  Fly    99 --------LKLTVCDTIG----YGDQVNK---ADSYKALVEYVDSQFEAYLQE---------ELK 139
                    :|:.|.||.|    :.||...   .:|.||.::........||..         ::.
plant   614 DVEGLVQGIKVRVIDTPGLLPSWSDQAKNEKILNSVKAFIKKNPPDIVLYLDRLDMQSRDSGDMP 678

  Fly   140 IQRAMA---------SAHDGRVHACLYFICPTGHG--LKAMDLVCMKQLDTRVNIIPVIAKADTI 193
            :.|.::         :|..|..||.  .:.|.|..  ..:.|:...::..       ||.:|...
plant   679 LLRTISDVFGPSIWFNAIVGLTHAA--SVPPDGPNGTASSYDMFVTQRSH-------VIQQAIRQ 734

  Fly   194 SKSELSGFKERIMDELRRNNVSIYQFPMDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRAR 258
            :..::     |:|     |.||:    :::.:...||.|....||...|.....:.::       
plant   735 AAGDM-----RLM-----NPVSL----VENHSACRTNRAGQRVLPNGQVWKPHLLLLS------- 778

  Fly   259 QYPWGAVHIENEAHC-----DFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSN 318
                .|..|..||:.     |.:..|....|:....|.          |....|.|       |.
plant   779 ----FASKILAEANALLKLQDNIPGRPFAARSKAPPLP----------FLLSSLLQ-------SR 822

  Fly   319 NQPVSFQQTF----------ESKRSDHLACLQAKEEEVRQM--FVQRVKQKENELKDNEKELHTK 371
            .||...:|.:          ||..||       :|.|..|:  |....|.:...|..::|:.:  
plant   823 PQPKLPEQQYGDEEDEDDLEESSDSD-------EESEYDQLPPFKSLTKAQMATLSKSQKKQY-- 878

  Fly   372 FDRLK-REHLEEKAQLEEARRQ 392
            .|.:: ||.|..|.|::|.|::
plant   879 LDEMEYREKLLMKKQMKEERKR 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 84/455 (18%)
CDC_Septin 43..311 CDD:206649 57/329 (17%)
BAR <252..405 CDD:299863 34/159 (21%)
TOC132NP_001324729.1 3a0901s04IAP86 454..1206 CDD:273381 91/477 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.