DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and sept15

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021326214.1 Gene:sept15 / 792259 ZFINID:ZDB-GENE-061103-265 Length:468 Species:Danio rerio


Alignment Length:437 Identity:163/437 - (37%)
Similarity:264/437 - (60%) Gaps:29/437 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVHLVTEKKTQEVATKVPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDT 65
            |:.|:..::..|            |:|||..||:|:..|||:.||.|.::.:||:.||||||:::
Zfish    42 MMELIQNQRNLE------------GYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINS 94

  Fly    66 LFNTSFGST----PSPHNLPNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYV 126
            ||.|...|.    ||......|:::.:...::|..|:|.||:.||.|:||.|:.::.::.::.|:
Zfish    95 LFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYI 159

  Fly   127 DSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKAD 191
            ||:||.:|..|.::.|....  |.|||.|||||.|:|||||.:|:..||:|..:||:||:|||||
Zfish   160 DSKFEDFLNAESRVNRRQMP--DNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKAD 222

  Fly   192 TISKSELSGFKERIMDELRRNNVSIYQFP-MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQV 255
            |::..|...||::||.|::.:.:.||:|| .:|:..|:....:...:|.|||||...::|.|::|
Zfish   223 TLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDSKLIRKIKEKMPLAVVGSNVVIEVNGRKV 287

  Fly   256 RARQYPWG----AVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVD 316
            |.||||||    .:.:||..||||..||.|||||:|:||::.|:..|||.:|.::|..:....||
Zfish   288 RGRQYPWGVAEEGIVVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVD 352

  Fly   317 SNNQPVSFQQT----FESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKR 377
            :........::    .|.:|.:|:..::..|.|:.|:|..:||:|:.:|||:|.||..:.:::|:
Zfish   353 ATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKK 417

  Fly   378 EHLEEKAQLEEARRQLEEDCQ--ELQRRRLQMANGSHTLTLGRGKKK 422
            ....:..:|||.|||.|::..  |.|:|.|:......:.|:.:.|||
Zfish   418 NLEAQYKELEEKRRQFEDEKANWEAQQRILEQQKLDASKTMEKNKKK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 151/381 (40%)
CDC_Septin 43..311 CDD:206649 116/276 (42%)
BAR <252..405 CDD:299863 60/162 (37%)
sept15XP_021326214.1 CDC_Septin 72..346 CDD:206649 116/275 (42%)
V-ATPase_G_2 367..>466 CDD:330366 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.