DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin7

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001107212.1 Gene:Septin7 / 64551 RGDID:620469 Length:437 Species:Rattus norvegicus


Alignment Length:427 Identity:176/427 - (41%)
Similarity:270/427 - (63%) Gaps:15/427 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKKTQEVATKVPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSF 71
            |:::...:|.|.:...|.|:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..
  Rat    11 EERSVNCSTMVAQPKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDL 75

  Fly    72 GST--PSP-HNL-PNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEA 132
            .|.  |.| |.: ..|:::.:...::|..|:|.||:.||.|:||.|:.::.::.:::|:||:||.
  Rat    76 YSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFED 140

  Fly   133 YLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSE 197
            ||..|.::.|....  |.||..|||||.|:|||||.:|:..||:|..:|||||:||||||::..|
  Rat   141 YLNAESRVNRRQMP--DNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEE 203

  Fly   198 LSGFKERIMDELRRNNVSIYQFP-MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYP 261
            ...||::||.|::.:.:.||:|| .|||..::....:...||.|||||...::|.||:||.||||
  Rat   204 CQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYP 268

  Fly   262 WGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQ 326
            ||...:||..||||..||.|||||:|:||::.|:..|||.:|.|:|..:.:..||:|.......:
  Rat   269 WGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTK 333

  Fly   327 T----FESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHLEEKAQLE 387
            :    .|.:|.:|:|.::..|.|:.|:|..:||:|..:|||:|.||..:.:::|:....:..:||
  Rat   334 SPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELE 398

  Fly   388 EARRQLEEDCQ--ELQRRRLQMANGSHTLTLGRGKKK 422
            |.|||.||:..  |.|:|.|:..|.|.||.  :.|||
  Rat   399 EKRRQFEEEKANWEAQQRILEQQNSSRTLE--KNKKK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 159/377 (42%)
CDC_Septin 43..311 CDD:206649 122/272 (45%)
BAR <252..405 CDD:299863 65/158 (41%)
Septin7NP_001107212.1 CDC_Septin 47..317 CDD:206649 122/271 (45%)
Interaction with SEPTIN12. /evidence=ECO:0000250|UniProtKB:Q16181 47..317 122/271 (45%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 57..64 4/6 (67%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 113..116 2/2 (100%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01056 194..197 2/2 (100%)
PRK12704 337..>433 CDD:237177 35/97 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..437 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.