DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin3

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038935716.1 Gene:Septin3 / 56003 RGDID:621745 Length:839 Species:Rattus norvegicus


Alignment Length:321 Identity:134/321 - (41%)
Similarity:200/321 - (62%) Gaps:11/321 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVHLVTEKKTQEVATKVPRLL--QLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLM 63
            |..||.|.:.:......|..:  .|.|::|.||:.:|:..|:::.||.|||:.:|::.||||||:
  Rat   495 MSELVPEPRPKPAVPMKPVSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLV 559

  Fly    64 DTLFNTSFGSTPSPHN----LP-NVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALV 123
            :|||.:......|..|    :| .|::||..:.::|..|::||||.||.|:|||:|..:.::.:.
  Rat   560 NTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIE 624

  Fly   124 EYVDSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIA 188
            :|::.|:|.:|:||:.|.| .....|.|||.|||||.||||.|:.:||..||.|...||:|||||
  Rat   625 KYINEQYEKFLKEEVNIAR-KKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNVIPVIA 688

  Fly   189 KADTISKSELSGFKERIMDELRRNNVSIY---QFPMDDETVSETNAAMNGHLPFAVVGSTEFVKV 250
            ||||::..|.|.||:|:..||..|.:..|   :|..|.|..:|.:......:|||||||.:..:|
  Rat   689 KADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQV 753

  Fly   251 AGKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMG 311
            .||:|..|:.|||.:.:||..||:|..||:.:|||:::||:|.||..|||.:|.:||...|
  Rat   754 NGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNG 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 128/295 (43%)
CDC_Septin 43..311 CDD:206649 121/275 (44%)
BAR <252..405 CDD:299863 29/60 (48%)
Septin3XP_038935716.1 CDC_Septin 540..814 CDD:206649 121/274 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51948
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.