DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and SEPTIN2

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_024308688.1 Gene:SEPTIN2 / 4735 HGNCID:7729 Length:428 Species:Homo sapiens


Alignment Length:362 Identity:149/362 - (41%)
Similarity:217/362 - (59%) Gaps:33/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKKTQEVATKVPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSF 71
            ::.||.:..:.|      |:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..
Human    71 QQPTQFINPETP------GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDL 129

  Fly    72 -------GSTPSPHNLPNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQ 129
                   |:......  .|:::|:|.|::|..|:|:|||.||.||||.:|..|.:|.::.|:|.|
Human   130 YPERVIPGAAEKIER--TVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQ 192

  Fly   130 FEAYLQEELKIQRAMASAH--DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADT 192
            ||.||.:|..:.|    .|  |.|||.|.|||.|.|||||.:|:..||.:..:|||:||||||||
Human   193 FERYLHDESGLNR----RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADT 253

  Fly   193 ISKSELSGFKERIMDELRRNNVSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGK 253
            ::..|....|:||:||:..:|:.||..|    .:||...|....:...:||:||||.:.::..||
Human   254 LTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGK 318

  Fly   254 QVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMG--FVDVD 316
            :||.|.||||.|.:||..|.||:|||.||| |:|:||:|.|...|||.||..||::.|  ..:.|
Human   319 KVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLKRGGRKVENED 382

  Fly   317 SNNQPVSFQQTFESKR-SDHLACLQAKEEEVRQMFVQ 352
            .|...:..::..|.:| .:.:|.:||:    .||.:|
Human   383 MNKDQILLEKEAELRRMQEMIARMQAQ----MQMQMQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 146/344 (42%)
CDC_Septin 43..311 CDD:206649 125/280 (45%)
BAR <252..405 CDD:299863 45/104 (43%)
SEPTIN2XP_024308688.1 Septin 102..373 CDD:307057 125/277 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.