DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and sept7a

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021323700.1 Gene:sept7a / 394136 ZFINID:ZDB-GENE-040426-1008 Length:443 Species:Danio rerio


Alignment Length:440 Identity:178/440 - (40%)
Similarity:273/440 - (62%) Gaps:24/440 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VTEKKTQEVATKVPRLL----QLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDT 65
            :.|:...|.|..|.|::    .|.|:|||..||:|:..|||:.||.|.::.:||:.||||||:::
Zfish     3 IGERSVTEAAGSVNRMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINS 67

  Fly    66 LFNTSFGST--PSP-HNL-PNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYV 126
            ||.|...|:  |.| |.: ..|:::.:...::|..|:|.||:.||.|:||.|:.::.::.:::::
Zfish    68 LFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHI 132

  Fly   127 DSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKAD 191
            ||:||.||..|.::.|....  |.|||.|||||.|:|||||.:|:..||:|..:|||||:|||||
Zfish   133 DSKFEDYLNAESRVNRRQMP--DSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKAD 195

  Fly   192 TISKSELSGFKERIMDELRRNNVSIYQFP-MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQV 255
            |::..|...||::||.|::.:.:.||:|| .|||..|:....:...||.|||||...::|.||:|
Zfish   196 TLTPEECQQFKKQIMREIQEHKIKIYEFPETDDEEESKLVKKIKDRLPLAVVGSNTIIEVNGKRV 260

  Fly   256 RARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNN- 319
            |.||||||...:||..||||..||.|||||:|:||::.|:..|||.:|.|:|..:.:..||:|. 
Zfish   261 RGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKN 325

  Fly   320 ----------QPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDR 374
                      :.:|.....|.:|.||:|.::..|.|:.|:|..:||:|..:|||:|.||..:.::
Zfish   326 KGQLTKPDTVEGMSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKIQKLKDSEGELQRRHEQ 390

  Fly   375 LKREHLEEKAQLEEARRQLEED--CQELQRRRLQMANGSHTLTLGRGKKK 422
            :|:....:..:|||.|||.||:  ..:.|:|.|:......:.||.:.|||
Zfish   391 MKKNLEAQHKELEEKRRQFEEEKASWDAQQRILEQQKLDASRTLEKNKKK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 162/384 (42%)
CDC_Septin 43..311 CDD:206649 123/272 (45%)
BAR <252..405 CDD:299863 66/165 (40%)
sept7aXP_021323700.1 CDC_Septin 45..315 CDD:206649 123/271 (45%)
DUF3552 366..>440 CDD:330423 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.