DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and zgc:63587

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_005172514.1 Gene:zgc:63587 / 393431 ZFINID:ZDB-GENE-040426-1175 Length:350 Species:Danio rerio


Alignment Length:356 Identity:148/356 - (41%)
Similarity:214/356 - (60%) Gaps:44/356 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNLP-------- 81
            |:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..  .|..: :|        
Zfish    15 GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDL--YPERY-IPGAAEKIER 76

  Fly    82 NVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMAS 146
            .|:::|:|.|::|..|:|:|||.||.||||.:|..|.:|.:::|:|:|||.||.:|..:.|    
Zfish    77 TVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFKTIIQYIDNQFERYLHDESGLNR---- 137

  Fly   147 AH--DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDEL 209
            .|  |.|||.|.|||.|.|||||.:|:..||.:.::|||:||||||||::..|....|.||:||:
Zfish   138 RHIVDNRVHCCFYFISPFGHGLKPLDVEFMKAIHSKVNIVPVIAKADTLTLKERDRLKRRILDEI 202

  Fly   210 RRNNVSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENE 270
            ..:.:.|||.|    .:||...|....:...:||||:||.:.::|.||::|.|.||||.|.:||.
Zfish   203 SEHGIRIYQLPDADSDEDEEFKEQTRVLKASIPFAVIGSNQLIEVKGKKIRGRLYPWGVVEVENP 267

  Fly   271 AHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMG----FVDVDSNNQPVSFQQTFESK 331
            .|.||:|||.||: |:|:||:|.|...|||.||..||::.|    ..||...:|           
Zfish   268 EHNDFLKLRTMLV-THMQDLQEVTQDLHYENFRSERLKRAGRAADVEDVMDKDQ----------- 320

  Fly   332 RSDHLACLQAKEEEVRQMFVQRVKQKENELK 362
                  .|..||.|:|:| .|.:.|.:.::|
Zfish   321 ------ILLEKEAELRRM-QQMIAQMQAQMK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 148/356 (42%)
CDC_Septin 43..311 CDD:206649 125/281 (44%)
BAR <252..405 CDD:299863 45/115 (39%)
zgc:63587XP_005172514.1 CDC3 15..325 CDD:227352 140/334 (42%)
Septin 33..305 CDD:279124 125/279 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.