DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Sep1

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_523430.1 Gene:Sep1 / 33114 FlyBaseID:FBgn0011710 Length:361 Species:Drosophila melanogaster


Alignment Length:349 Identity:147/349 - (42%)
Similarity:215/349 - (61%) Gaps:32/349 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNL----- 80
            ::..|:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..    .|..:     
  Fly    10 IETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDL----YPERIIPDAI 70

  Fly    81 ----PNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQ 141
                ..|||:|:|.|::|..|:|:|||.||.|:||.::.::|:.|::||:|.|:|.:|::|..:.
  Fly    71 EKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLN 135

  Fly   142 RAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIM 206
            |  .:..|.|:|.|.|||.|.|||||.:|:..||:|.::|||:|||||||.::|.|:...|.|||
  Fly   136 R--RNIVDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIM 198

  Fly   207 DELRRNNVSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHI 267
            .|:..:.:.||..|    .:||...|....:...:||||.|:...::|.||:||.|.||||.|.:
  Fly   199 QEIESHGIKIYPLPDCDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEV 263

  Fly   268 ENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRL------QQMGF-VDVDSNNQPVSFQ 325
            ||..||||:|||.||| |:|:||:|.|...|||.:|..||      ::.|. .:.||::|.||..
  Fly   264 ENPDHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVSNS 327

  Fly   326 QTFESKRSDHLACLQAKEEEVRQM 349
            ...|..|     .||.||.|:|:|
  Fly   328 VLGEKDR-----ILQEKEAELRRM 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 147/345 (43%)
CDC_Septin 43..311 CDD:206649 122/286 (43%)
BAR <252..405 CDD:299863 49/105 (47%)
Sep1NP_523430.1 CDC3 13..342 CDD:227352 144/340 (42%)
Septin 32..304 CDD:279124 122/278 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107010at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18884
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.