DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin4

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038941491.1 Gene:Septin4 / 287606 RGDID:1308781 Length:1000 Species:Rattus norvegicus


Alignment Length:366 Identity:143/366 - (39%)
Similarity:219/366 - (59%) Gaps:23/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTS-------FGSTPSPHNLPNV 83
            :|||.|||:|:..|||:.||.|.::..||:.||||||:::||.|.       .|:  ....:..|
  Rat   646 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGA--EERIMQTV 708

  Fly    84 KLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAH 148
            ::..:..:::|..|||:||:.||.|:||.||..:.::.:.||:|.|||.|.::|..:.|  .:..
  Rat   709 EITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWRPVAEYIDQQFEQYFRDESGLNR--KNIQ 771

  Fly   149 DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNN 213
            |.|||.|||||.|.||||:.:|:..||.|..||||:|::|||||::.||:...|.:|.:|:....
  Rat   772 DNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPSEVDRKKCKIREEIEHFG 836

  Fly   214 VSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCD 274
            :.|||||    .:||.....:.|:...:||||:||...|:..|::||.|.||||.|.:||..|||
  Rat   837 IKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCD 901

  Fly   275 FVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRSDHL-AC 338
            |||||.||:||:|:||::.|...|||.:|.:.:|.|..:.|...|:.   :.|.||.....: |.
  Rat   902 FVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRN---KLTRESGTDFPIPAV 963

  Fly   339 LQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREH 379
            ....:.|..::    :::|:.||:..::.||....::|..|
  Rat   964 PPGTDPETEKL----IREKDEELRRMQEMLHKIQRQMKETH 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 143/366 (39%)
CDC_Septin 43..311 CDD:206649 118/278 (42%)
BAR <252..405 CDD:299863 47/129 (36%)
Septin4XP_038941491.1 DUF4655 14..538 CDD:406085
Septin 664..936 CDD:395596 117/275 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.