DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and spn3

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001342704.1 Gene:spn3 / 2540029 PomBaseID:SPBC16A3.01 Length:412 Species:Schizosaccharomyces pombe


Alignment Length:400 Identity:120/400 - (30%)
Similarity:197/400 - (49%) Gaps:75/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KSVQNGFSFNILCIGETALGKSTLMDTL-----------FNTSFGSTPSPHNLPNVKLKANTYEL 92
            ||.:.|...|::.:|:..||::..::||           |:.:..|:.||..:    :...|..:
pombe    45 KSSKKGIPLNLMVVGDVGLGRTAFINTLCEKPLIRHNNNFDPAEASSVSPVEI----VPYQTDII 105

  Fly    93 QESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHDGRVHACLY 157
            .|...::.|||.||..:|:.::..:::..:::|::||::..|:||.:|:| .|...|.||||.:|
pombe   106 LEDGTKINLTVLDTPHFGEAIDNENNFDIILQYIESQYDNVLEEESRIKR-NARFCDDRVHALIY 169

  Fly   158 FICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNVSIYQFPM- 221
            ||.||||||:.:|:..|::|..||||||.|||||:::..||...||.|..::....:.:|.||. 
pombe   170 FISPTGHGLRELDIELMRRLAPRVNIIPAIAKADSLTAQELQTTKEMINADIEYYKIPVYDFPYD 234

  Fly   222 ---DDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCDFVKLREMLI 283
               |:|.:...:..:...:|||:|.|...:::.|:.||.|.||||.|.::|..|.||:.||..|.
pombe   235 IEEDEEAIINLSQQLRATIPFAIVSSDRLIEMNGQTVRGRAYPWGVVEVDNPRHSDFLALRSALF 299

  Fly   284 RTNMEDLREQTHTRHYELFRQRRLQQM-----GFVDVDSNNQPVSFQQTFESKRSDHLACLQAKE 343
            .|::|||...|..:.||.:|..:|...     ..|.:|..|                        
pombe   300 ATHIEDLHNITSNQLYETYRTEKLSTSQLLLDSTVGLDGKN------------------------ 340

  Fly   344 EEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHLEEKAQLEEARRQL---EEDCQELQRR-- 403
                      :.|.:..|::         |||:...|..:.::||.||||   ||..:.|:.:  
pombe   341 ----------LSQHDQVLRE---------DRLRAIELSVQKEIEEKRRQLLAREEALRALEEKLA 386

  Fly   404 --RLQMANGS 411
              ...|||.|
pombe   387 ASTAAMANAS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 113/377 (30%)
CDC_Septin 43..311 CDD:206649 96/287 (33%)
BAR <252..405 CDD:299863 43/164 (26%)
spn3NP_001342704.1 Septin 50..325 CDD:307057 96/279 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18884
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.